Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,461 – 2,475 of 1,660,841 results

2,461

Invitrogen™ Nur77 Monoclonal Antibody (12.14), eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P12813
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	Nur77
Gene Symbols	NR4A1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	early response protein NAK1; Gfrp; GFRP1; growth factor-inducible nuclear protein N10; Hbr1; Hbr-1; Hmr; hormone receptor; immediate early gene transcription factor NGFI-B; MGC9485; N10; NAK1; NAK-1; nerve growth factor IB nuclear receptor variant 1; nerve growth factor induced protein I-B; nerve growth factor-induced protein I-B; Ngfib; NGFI-B; NP10; Nr4a1; Nuclear hormone receptor NUR/77; nuclear protein N10; Nuclear receptor subfamily 4 group A member 1; nuclear receptor subfamily 4, group A, member 1; NUR77; Orphan nuclear receptor HMR; orphan nuclear receptor TR3; Orphan receptor tr3; ST-59; steroid receptor TR3; testicular receptor 3; TIS1; TR3; TR3 orphan receptor
Gene	NR4A1
Product Type	Antibody
Gene ID (Entrez)	15370
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	12.14

2,462

Invitrogen™ CD71 (Transferrin Receptor) Monoclonal Antibody (OKT9 (OKT-9)), Brilliant Ultra Violet™ 615, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 615
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P02786
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD71 (Transferrin Receptor)
Gene Symbols	TFRC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene	TFRC
Product Type	Antibody
Gene ID (Entrez)	7037
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OKT9 (OKT-9)

2,463

Invitrogen™ ATF6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Western Blot
Form	Liquid
Gene Accession No.	F6VAN0, O35451, P18850, Q99941
Isotype	IgG
Concentration	1 mg/mL
Antigen	ATF6
Gene Symbols	ATF6, ATF6B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9130025P16Rik; 9630036G24; AA617266; AA789574; ACHM7; activating transcription factor 6; activating transcription factor 6 alpha; Activating transcription factor 6 beta; ATF 6; Atf6; ATF6 alpha; ATF6A; Atf6alpha; ATF6-alpha; Atf6b; ATF6beta; ATF6-beta; cAMP response element binding protein-related protein; cAMP response element-binding protein-related protein; cAMP responsive element binding protein-like 1; cAMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 beta; cAMP-responsive element-binding protein-like 1; Crebl1; Creb-related protein; CREB-RP; Cyclic AMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 beta; DKFZp686P2194; ESTM49; FLJ21663; G13; Processed cyclic AMP-dependent transcription factor ATF-6 alpha; Processed cyclic AMP-dependent transcription factor ATF-6 beta; Protein G13
Gene	ATF6B
Product Type	Antibody
Gene ID (Entrez)	12915, 1388, 226641, 22926
Formulation	PBS with 0.02% sodium azide
Immunogen	A 17 amino acid peptide from near the amino terminus of human ATF6.
Classification	Polyclonal
Primary or Secondary	Primary

2,464

Invitrogen™ ST2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14719, Q01638
Isotype	IgG
Concentration	1 mg/mL
Antigen	ST2
Gene Symbols	IL1RL1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	DER4; Fit1; Fit-1; Fos-responsive gene 1 protein; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; IL-1 R4; IL1RL1; IL-1RL1; IL33R; IL-33R; interleukin 1 receptor like 1; interleukin 1 receptor-like 1; interleukin 1 receptor-related protein; Interleukin1 receptor like 1; interleukin-1 receptor-like 1; Interleukin-33 receptor alpha chain; Ly84; lymphocyte antigen 84; Protein ST2; Protein T1; sIL 33R; soluble IL 33 Receptor; soluble IL 33R; St2; ST2L; St2-rs1; ST2V; Ste2; T1; T1/ST2
Gene	IL1RL1
Product Type	Antibody
Gene ID (Entrez)	17082, 9173
Formulation	PBS with 0.02% sodium azide
Immunogen	A synthetic peptide corresponding to 16 amino acids at the amino-terminus of mouse ST2.
Classification	Polyclonal
Primary or Secondary	Primary

2,465

Invitrogen™ RIP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q13546, Q60855
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	RIP1
Gene Symbols	RIPK1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	cell death protein RIP; D330015H01Rik; FLJ39204; OTTHUMP00000015955; receptor (TNFRSF)-interacting serine-threonine kinase 1; receptor interacting serine/threonine kinase 1; receptor-interacting protein 1; receptor-interacting protein kinase 1; receptor-interacting serine/threonine-protein kinase 1; Rinp; RIP; RIP1; RIP-1; RIP1 (CT); RIPK1; serine/threonine-protein kinase RIP
Gene	RIPK1
Product Type	Antibody
Gene ID (Entrez)	19766, 306886, 8737
Formulation	PBS with 0.02% sodium azide
Immunogen	A 15 amino acid peptide from near the amino terminus of human RIPK1.
Classification	Polyclonal
Primary or Secondary	Primary

2,466

Invitrogen™ PROX1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P48437, Q92786
Isotype	IgG
Concentration	0.50 mg/mL
Antigen	PROX1
Gene Symbols	Prox1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	A230003G05Rik; homeobox prospero-like protein PROX1; prospero homeobox 1; prospero homeobox protein 1; prospero-related homeobox 1; Prox 1; PROX1; PROX-1
Gene	Prox1
Product Type	Antibody
Gene ID (Entrez)	19130, 5629
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 492-520 amino acids from human PROX1.
Classification	Polyclonal
Primary or Secondary	Primary

2,467

Invitrogen™ LIPA Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P38571, Q9Z0M5
Isotype	IgG
Concentration	1.33 mg/mL
Antigen	LIPA
Gene Symbols	LIPA
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA960673; Acid cholesteryl ester hydrolase; CESD; Chole; Chole2; cholesterol ester hydrolase; Cholesterol esterase (pancreatic) see D3Wox12 D3Wox13 D3Wox26 and D3Mgh25; cholesteryl esterase; HGCLAS; HUSSY-01; LAL; LAS; LIAS; Lip1; Lip-1; Lipa; Lipase A; lipase A, lysosomal acid type; lipase A, lysosomal acid, cholesterol esterase; lipoate synthase; Lipoic acid synthase; lipoic acid synthetase; lipoyl synthase, mitochondrial; lip-syn; LS; lysosomal acid lipase; lysosomal acid lipase 1; lysosomal acid lipase A; lysosomal acid lipase/cholesteryl ester hydrolase; pancreatic cholesterol esterase; PDHLD; RP11-341B24.1; Sterol esterase
Gene	LIPA
Product Type	Antibody
Gene ID (Entrez)	16889, 3988
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human LAL. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

2,468

Invitrogen™ MIF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14174, P30904, P34884
Isotype	IgG
Concentration	0.1 mg/mL
Antigen	MIF
Gene Symbols	Mif
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	cytokine; delayed early response protein 6; DER6; GIF; GLIF; glutathione-binding 13 kDa protein; Glycosylation-inhibiting factor; HGNC:7097; L-dopachrome isomerase; L-dopachrome tautomerase; macrophage migration inhibitory factor; macrophage migration inhibitory factor (glycosylation-inhibiting factor); MGC107654; Mif; MMIF; phenylpyruvate tautomerase
Gene	Mif
Product Type	Antibody
Gene ID (Entrez)	17319, 4282, 81683
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human MIF. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

2,469

Invitrogen™ Prostate Specific Acid Phosphatase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P15309, P20646, Q8CE08
Isotype	IgG
Concentration	500 μg/mL
Antigen	Prostate Specific Acid Phosphatase
Gene Symbols	ACP3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	5'-NT; 5'-nucleotidase; A030005E02Rik; acid phosphatase, prostate; ACP3; ACP-3; Acpp; Acpp11; EC 3.1.3.2; Ecto-5'-nucleotidase; fluoride-resistant acid phosphatase; FRAP; Lap; lysosomal acid phosphatase; PAP; PAPf39; Ppal; PPAP; prostate acid phosphatase; Prostatic acid phosphatase; prostatic acid phosphatase (rPAP); prostatic acid phosphotase; RNACPP11; Thiamine monophosphatase; TMPase
Gene	ACP3
Product Type	Antibody
Gene ID (Entrez)	55, 56318, 56780
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E.coli-derived human PAP/ACP3 recombinant protein (Position: E150-D386).
Classification	Polyclonal
Primary or Secondary	Primary

2,470

Invitrogen™ Zap-70 Monoclonal Antibody (ZAP-70-6F7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P43403, P43404
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	Zap-70
Gene Symbols	ZAP70
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	70 kDa zeta-associated protein; 70 kDa zeta-chain associated protein; ADMIO2; EC 2.7.10.2; FLJ17670; FLJ17679; I79_004087; IMD48; kinase ZAP70; mrtle; mur; Selective T cell defect; Srk; STCD; STD; syk-related protein tyrosine kinase; syk-related tyrosine kinase; Tyrosine-protein kinase ZAP-70; Tyrosine-protein kinase ZAP-70;TZK; TZK; ZA70; Zap70; ZAP-70; Zeta chain associated protein kinase 70kDa; zeta chain of T cell receptor associated protein kinase; zeta chain of T cell receptor associated protein kinase 70; zeta chain of T cell receptor associated protein kinase 70kDa; zeta-chain (TCR) associated protein kinase; zeta-chain (TCR) associated protein kinase 70; zeta-chain (TCR) associated protein kinase 70kDa; zeta-chain associated protein kinase 70kDa; zeta-chain associated protein kinase, 70kD
Gene	ZAP70
Product Type	Antibody
Gene ID (Entrez)	22637, 7535
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Peptide derived from a.a. 326-341 of human ZAP-70.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ZAP-70-6F7

2,471

Invitrogen™ TRPV1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	Q8NER1
Isotype	IgG
Concentration	1 mg/mL
Antigen	TRPV1
Gene Symbols	TRPV1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Capsaicin receptor; cation channel; DKFZp434K0220; non-selective cation channel; osm-9-like TRP channel 1; OTRPC1; si:dkey-9e15.2; transient receptor potential cation channel subfamily V member 1; transient receptor potential cation channel V1; transient receptor potential cation channel, subfamily V, member 1; transient receptor potential V1; transient receptor potential V1 channel; transient receptor potential vanilloid 1 supraoptic nucleus; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; TRPV1; TRPV1/2; TRPV1_SON; TRPV1alpha; TRPV1beta; Vanilloid receptor; vanilloid receptor 1; vanilloid receptor subtype 1; vanilloid receptor type 1 like protein 1; Vanilloid receptor type 1-like; vanilloid type 1 receptor; VR.5'sv; Vr1; VR-1; Vr1l; Vr1l1
Gene	TRPV1
Product Type	Antibody
Gene ID (Entrez)	7442
Formulation	PBS with 0.02% sodium azide
Immunogen	A 16 amino acid peptide near the carboxy terminus of human TRPV1.
Classification	Polyclonal
Primary or Secondary	Primary

2,472

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	Q13148
Research Discipline	Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites
Antigen	TDP-43/TARDBP
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated
Gene Alias	ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43
Gene ID (Entrez)	23435
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Primary or Secondary	Primary
Clone	2E2-D3

2,473

Invitrogen™ KLH Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Tag,Tag
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	KLH
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	keyhole limpet hemocyanin
Product Type	Antibody
Formulation	PBS with no preservative
Immunogen	Recombinant KLH protein.
Classification	Polyclonal
Primary or Secondary	Primary

2,474

Ki-67 Recombinant Rat Monoclonal Antibody (SolA15), Biotin, Invitrogen™

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rat
Conjugate	Biotin
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	E9PVX6, P46013
Concentration	1.0 mg/mL
Antigen	Ki-67
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene	Mki67
Product Type	Antibody
Gene ID (Entrez)	17345, 4288
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SolA15

2,475

Invitrogen™ CD14 Monoclonal Antibody (TuK4), Pacific Orange™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	Pacific Orange
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P08571
Isotype	IgG2a
Antigen	CD14
Gene Symbols	Cd14
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	CD 14; CD14; CD14 antigen; CD14 molecule; cd14 monocyte; lipopolysaccharide receptor; lipoprotein receptor; LPSR antibody; monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14, membrane-bound form; Monocyte differentiation antigen CD14, urinary form; monocyte differentiation antigen CD14; LOW QUALITY PROTEIN: monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; myeloid membrane glycoprotein precursor; sCD14; soluble CD14
Gene	Cd14
Product Type	Antibody
Gene ID (Entrez)	929
Formulation	PBS with BSA and 0.1% sodium azide
Immunogen	Human CD14.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TuK4

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Nur77 Monoclonal Antibody (12.14), eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ATF6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ST2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RIP1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PROX1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ LIPA Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MIF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Prostate Specific Acid Phosphatase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Zap-70 Monoclonal Antibody (ZAP-70-6F7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TRPV1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Invitrogen™ KLH Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Nur77 Monoclonal Antibody (12.14), eBioscience™

Invitrogen™ ATF6 Polyclonal Antibody

Invitrogen™ ST2 Polyclonal Antibody

Invitrogen™ RIP1 Polyclonal Antibody

Invitrogen™ PROX1 Polyclonal Antibody

Invitrogen™ LIPA Polyclonal Antibody

Invitrogen™ MIF Polyclonal Antibody

Invitrogen™ Prostate Specific Acid Phosphatase Polyclonal Antibody

Invitrogen™ Zap-70 Monoclonal Antibody (ZAP-70-6F7)

Invitrogen™ TRPV1 Polyclonal Antibody

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™

Invitrogen™ KLH Polyclonal Antibody